PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 368aa    MW: 41380.3 Da    PI: 6.5013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018024.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd  lv++++++G+g+W+  ++  g+ R++k+c++rw +yl
      Pbr018024.1 14 KGPWTTEEDAVLVNYIQKHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.61e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr + eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Pbr018024.1  67 RGRISFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNHWNTH 111
                      79999*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.339965IPR017930Myb domain
SuperFamilySSF466895.62E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001671.29E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2565116IPR009057Homeodomain-like
SMARTSM007179.6E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.51266116IPR017930Myb domain
PfamPF002499.8E-1567111IPR001005SANT/Myb domain
CDDcd001671.09E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTTE EDAVLVNYIQ KHGPGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRI SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNHWNT HIRKRLLRMG  120
IDPVTHAPRI DFLDLSSILS SYVCNNPAAA LLNLSNLLNS TQQQQPLVNP ELLRLATSLL  180
SIKQENPELC PQNYTLHQNQ ICSSQEQNNQ VLPPLQSNDQ FQNLIQGGDF SADMAKHLMQ  240
QIDVEAYSPN MNNLSCPLSQ ENIVPSNLST DHHQTAVSQP NYVPCSTTSS SPKPDFPENS  300
YFQSLNYNKN HNFSFDSVMS TPYSSPTPLN SSGTYINSST EDEKESYCSS WLKFEIPEST  360
VDISDIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-30121162105C-Myb DNA-Binding Domain
1msf_C5e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744660.0DQ074466.1 Malus x domestica MYB18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353208.10.0PREDICTED: protein ODORANT1-like
TrEMBLQ2LME60.0Q2LME6_MALDO; MYB domain class transcription factor
STRINGPOPTR_0019s14070.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.16e-96MYB-like 102